CTNS,CTNS-LSB,PQLC4
  • CTNS,CTNS-LSB,PQLC4

Anti-CTNS Antibody 25ul

Ref: AN-HPA046947-25ul
Anti-CTNS

Información del producto

Polyclonal Antibody against Human CTNS, Gene description: cystinosin, lysosomal cystine transporter, Alternative Gene Names: CTNS-LSB, PQLC4, Validated applications: ICC, Uniprot ID: O60931, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CTNS
Gene Description cystinosin, lysosomal cystine transporter
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FPQAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKF
Immunogen FPQAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CTNS-LSB, PQLC4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60931
HTS Code 3002150000
Gene ID 1497
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CTNS Antibody 25ul

Anti-CTNS Antibody 25ul