CLK3,clk3
  • CLK3,clk3

Anti-CLK3 Antibody 100ul

Ref: AN-HPA046817-100ul
Anti-CLK3

Información del producto

Polyclonal Antibody against Human CLK3, Gene description: CDC-like kinase 3, Alternative Gene Names: clk3, Validated applications: ICC, IHC, WB, Uniprot ID: P49761, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CLK3
Gene Description CDC-like kinase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence RHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKE
Immunogen RHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names clk3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49761
HTS Code 3002150000
Gene ID 1198
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CLK3 Antibody 100ul

Anti-CLK3 Antibody 100ul