C6orf136
  • C6orf136

Anti-C6orf136 Antibody 100ul

Ref: AN-HPA046804-100ul
Anti-C6orf136

Información del producto

Polyclonal Antibody against Human C6orf136, Gene description: chromosome 6 open reading frame 136, Alternative Gene Names: Em:AB023049.8, Validated applications: IHC, Uniprot ID: Q5SQH8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C6orf136
Gene Description chromosome 6 open reading frame 136
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EGPGPELHSGCLDGLRSLFEGPPCPYPGAWIPFQVPGTAHPSPATPSGDPSMEEHLSVMYERLRQELPKLFLQSHDYSLYSLDV
Immunogen EGPGPELHSGCLDGLRSLFEGPPCPYPGAWIPFQVPGTAHPSPATPSGDPSMEEHLSVMYERLRQELPKLFLQSHDYSLYSLDV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Em:AB023049.8
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5SQH8
HTS Code 3002150000
Gene ID 221545
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C6orf136 Antibody 100ul

Anti-C6orf136 Antibody 100ul