URB2,KIAA0133,NET10
  • URB2,KIAA0133,NET10

Anti-URB2 Antibody 100ul

Ref: AN-HPA046788-100ul
Anti-URB2

Información del producto

Polyclonal Antibody against Human URB2, Gene description: URB2 ribosome biogenesis 2 homolog (S. cerevisiae), Alternative Gene Names: KIAA0133, NET10, NPA2, Validated applications: ICC, Uniprot ID: Q14146, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name URB2
Gene Description URB2 ribosome biogenesis 2 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PEGAVVAQLFEVIHLALGHYLLILQQQVNPRRAFGDVTAHLLQPCLVLRHLLSGGTWTQAGQGQLRQVLSRDIRSQIEAMFRGGIFQPELLSSYKEGLLDQQQGDVKTGAMKNLLAPMDTVLNRLVDAGYCAASL
Immunogen PEGAVVAQLFEVIHLALGHYLLILQQQVNPRRAFGDVTAHLLQPCLVLRHLLSGGTWTQAGQGQLRQVLSRDIRSQIEAMFRGGIFQPELLSSYKEGLLDQQQGDVKTGAMKNLLAPMDTVLNRLVDAGYCAASL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0133, NET10, NPA2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14146
HTS Code 3002150000
Gene ID 9816
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-URB2 Antibody 100ul

Anti-URB2 Antibody 100ul