CNOT9,CAF40,CT129
  • CNOT9,CAF40,CT129

Anti-CNOT9 Antibody 100ul

Ref: AN-HPA046622-100ul
Anti-CNOT9

Información del producto

Polyclonal Antibody against Human CNOT9, Gene description: CCR4-NOT transcription complex subunit 9, Alternative Gene Names: CAF40, CT129, RCD1, RCD1+, RQCD1, Validated applications: IHC, Uniprot ID: Q92600, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CNOT9
Gene Description CCR4-NOT transcription complex subunit 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence WHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTS
Immunogen WHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAF40, CT129, RCD1, RCD1+, RQCD1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92600
HTS Code 3002150000
Gene ID 9125
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CNOT9 Antibody 100ul

Anti-CNOT9 Antibody 100ul