SPSB3,C16orf31,SSB-3
  • SPSB3,C16orf31,SSB-3

Anti-SPSB3 Antibody 100ul

Ref: AN-HPA046602-100ul
Anti-SPSB3

Información del producto

Polyclonal Antibody against Human SPSB3, Gene description: splA/ryanodine receptor domain and SOCS box containing 3, Alternative Gene Names: C16orf31, SSB-3, Validated applications: ICC, IHC, Uniprot ID: Q6PJ21, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SPSB3
Gene Description splA/ryanodine receptor domain and SOCS box containing 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence KVSFHMEYSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATKLQNKRFYPMVC
Immunogen KVSFHMEYSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATKLQNKRFYPMVC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C16orf31, SSB-3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6PJ21
HTS Code 3002150000
Gene ID 90864
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SPSB3 Antibody 100ul

Anti-SPSB3 Antibody 100ul