LPAR4,GPR23,LPA4
  • LPAR4,GPR23,LPA4

Anti-LPAR4 Antibody 100ul

Ref: AN-HPA046563-100ul
Anti-LPAR4

Información del producto

Polyclonal Antibody against Human LPAR4, Gene description: lysophosphatidic acid receptor 4, Alternative Gene Names: GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9, Validated applications: ICC, Uniprot ID: Q99677, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LPAR4
Gene Description lysophosphatidic acid receptor 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM
Immunogen KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99677
HTS Code 3002150000
Gene ID 2846
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LPAR4 Antibody 100ul

Anti-LPAR4 Antibody 100ul