RPA1,HSSB,REPA1
  • RPA1,HSSB,REPA1

Anti-RPA1 Antibody 25ul

Ref: AN-HPA046497-25ul
Anti-RPA1

Información del producto

Polyclonal Antibody against Human RPA1, Gene description: replication protein A1, 70kDa, Alternative Gene Names: HSSB, REPA1, RF-A, RP-A, RPA70, Validated applications: ICC, WB, Uniprot ID: P27694, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RPA1
Gene Description replication protein A1, 70kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence PVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEK
Immunogen PVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSSB, REPA1, RF-A, RP-A, RPA70
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P27694
HTS Code 3002150000
Gene ID 6117
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RPA1 Antibody 25ul

Anti-RPA1 Antibody 25ul