CASP9,APAF-3
  • CASP9,APAF-3

Anti-CASP9 Antibody 25ul

Ref: AN-HPA046488-25ul
Anti-CASP9

Información del producto

Polyclonal Antibody against Human CASP9, Gene description: caspase 9, apoptosis-related cysteine peptidase, Alternative Gene Names: APAF-3, ICE-LAP6, MCH6, PPP1R56, Validated applications: IHC, Uniprot ID: P55211, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CASP9
Gene Description caspase 9, apoptosis-related cysteine peptidase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLR
Immunogen SPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APAF-3, ICE-LAP6, MCH6, PPP1R56
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P55211
HTS Code 3002150000
Gene ID 842
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CASP9 Antibody 25ul

Anti-CASP9 Antibody 25ul