DEFB132,DEFB32
  • DEFB132,DEFB32

Anti-DEFB132 Antibody 100ul

Ref: AN-HPA046399-100ul
Anti-DEFB132

Información del producto

Polyclonal Antibody against Human DEFB132, Gene description: defensin, beta 132, Alternative Gene Names: DEFB32, RP5-1103G7.6, Validated applications: IHC, Uniprot ID: Q7Z7B7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DEFB132
Gene Description defensin, beta 132
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
Immunogen PGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DEFB32, RP5-1103G7.6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z7B7
HTS Code 3002150000
Gene ID 400830
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DEFB132 Antibody 100ul

Anti-DEFB132 Antibody 100ul