ZBTB7A,DKFZp547O146
  • ZBTB7A,DKFZp547O146

Anti-ZBTB7A Antibody 25ul

Ref: AN-HPA046387-25ul
Anti-ZBTB7A

Información del producto

Polyclonal Antibody against Human ZBTB7A, Gene description: zinc finger and BTB domain containing 7A, Alternative Gene Names: DKFZp547O146, FBI-1, LRF, pokemon, ZBTB7, ZNF857A, Validated applications: ICC, IHC, Uniprot ID: O95365, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZBTB7A
Gene Description zinc finger and BTB domain containing 7A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence AVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSN
Immunogen AVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp547O146, FBI-1, LRF, pokemon, ZBTB7, ZNF857A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95365
HTS Code 3002150000
Gene ID 51341
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZBTB7A Antibody 25ul

Anti-ZBTB7A Antibody 25ul