SNX21,C20orf161
  • SNX21,C20orf161

Anti-SNX21 Antibody 25ul

Ref: AN-HPA046359-25ul
Anti-SNX21

Información del producto

Polyclonal Antibody against Human SNX21, Gene description: sorting nexin family member 21, Alternative Gene Names: C20orf161, dJ337O18.4, SNX-L, Validated applications: ICC, IHC, Uniprot ID: Q969T3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SNX21
Gene Description sorting nexin family member 21
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence RAQSLTCTGLYREALALWANAWQLQAQLGTPSGPDRPLLTLAGLAVCHQELEDPGEARACCEKALQLLGDKSLHPLLAPFLEAHVRLSWRLGLDKRQSEA
Immunogen RAQSLTCTGLYREALALWANAWQLQAQLGTPSGPDRPLLTLAGLAVCHQELEDPGEARACCEKALQLLGDKSLHPLLAPFLEAHVRLSWRLGLDKRQSEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf161, dJ337O18.4, SNX-L
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q969T3
HTS Code 3002150000
Gene ID 90203
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SNX21 Antibody 25ul

Anti-SNX21 Antibody 25ul