GDAP2,dJ776P7.1
  • GDAP2,dJ776P7.1

Anti-GDAP2 Antibody 25ul

Ref: AN-HPA046185-25ul
Anti-GDAP2

Información del producto

Polyclonal Antibody against Human GDAP2, Gene description: ganglioside induced differentiation associated protein 2, Alternative Gene Names: dJ776P7.1, FLJ20142, MACROD3, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NXN4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GDAP2
Gene Description ganglioside induced differentiation associated protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LNSSDTTAEIFQEDTVRSPFLYNKDVNGKVVLWKGDVALLNCTAIVNTSNESLTDKNPVSESIFMLAGPDLKEDLQKLKGCRTGEAKL
Immunogen LNSSDTTAEIFQEDTVRSPFLYNKDVNGKVVLWKGDVALLNCTAIVNTSNESLTDKNPVSESIFMLAGPDLKEDLQKLKGCRTGEAKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names dJ776P7.1, FLJ20142, MACROD3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NXN4
HTS Code 3002150000
Gene ID 54834
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GDAP2 Antibody 25ul

Anti-GDAP2 Antibody 25ul