ELL,C19orf17,ELL1
  • ELL,C19orf17,ELL1

Anti-ELL Antibody 25ul

Ref: AN-HPA046076-25ul
Anti-ELL

Información del producto

Polyclonal Antibody against Human ELL, Gene description: elongation factor RNA polymerase II, Alternative Gene Names: C19orf17, ELL1, Men, PPP1R68, Validated applications: IHC, WB, Uniprot ID: P55199, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ELL
Gene Description elongation factor RNA polymerase II
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence ANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLG
Immunogen ANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C19orf17, ELL1, Men, PPP1R68
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P55199
HTS Code 3002150000
Gene ID 8178
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ELL Antibody 25ul

Anti-ELL Antibody 25ul