COQ10B,FLJ13448
  • COQ10B,FLJ13448

Anti-COQ10B Antibody 100ul

Ref: AN-HPA046057-100ul
Anti-COQ10B

Información del producto

Polyclonal Antibody against Human COQ10B, Gene description: coenzyme Q10 homolog B (S. cerevisiae), Alternative Gene Names: FLJ13448, Validated applications: ICC, IHC, Uniprot ID: Q9H8M1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name COQ10B
Gene Description coenzyme Q10 homolog B (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRK
Immunogen ARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ13448
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H8M1
HTS Code 3002150000
Gene ID 80219
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-COQ10B Antibody 100ul

Anti-COQ10B Antibody 100ul