CXCR3,CD183,CKR-L2
  • CXCR3,CD183,CKR-L2

Anti-CXCR3 Antibody 100ul

Ref: AN-HPA045942-100ul
Anti-CXCR3

Información del producto

Polyclonal Antibody against Human CXCR3, Gene description: chemokine (C-X-C motif) receptor 3, Alternative Gene Names: CD183, CKR-L2, CMKAR3, GPR9, IP10-R, MigR, Validated applications: IHC, Uniprot ID: P49682, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CXCR3
Gene Description chemokine (C-X-C motif) receptor 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAF
Immunogen QVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD183, CKR-L2, CMKAR3, GPR9, IP10-R, MigR
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49682
HTS Code 3002150000
Gene ID 2833
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CXCR3 Antibody 100ul

Anti-CXCR3 Antibody 100ul