SPESP1,SP-ESP
  • SPESP1,SP-ESP

Anti-SPESP1 Antibody 25ul

Ref: AN-HPA045936-25ul
Anti-SPESP1

Información del producto

Polyclonal Antibody against Human SPESP1, Gene description: sperm equatorial segment protein 1, Alternative Gene Names: SP-ESP, Validated applications: IHC, WB, Uniprot ID: Q6UW49, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SPESP1
Gene Description sperm equatorial segment protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence YPSITVTPDEEQNLNHYIQVLENLVRSVPSGEPGREKKSNSPKHVYSIASKGSKFKELVTHGDASTENDVLTNPISEETTTFPTG
Immunogen YPSITVTPDEEQNLNHYIQVLENLVRSVPSGEPGREKKSNSPKHVYSIASKGSKFKELVTHGDASTENDVLTNPISEETTTFPTG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SP-ESP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6UW49
HTS Code 3002150000
Gene ID 246777
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SPESP1 Antibody 25ul

Anti-SPESP1 Antibody 25ul