DPH2,DPH2L2
  • DPH2,DPH2L2

Anti-DPH2 Antibody 25ul

Ref: AN-HPA045796-25ul
Anti-DPH2

Información del producto

Polyclonal Antibody against Human DPH2, Gene description: DPH2 homolog (S. cerevisiae), Alternative Gene Names: DPH2L2, Validated applications: ICC, IHC, Uniprot ID: Q9BQC3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DPH2
Gene Description DPH2 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence DPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLSRL
Immunogen DPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLSRL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DPH2L2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BQC3
HTS Code 3002150000
Gene ID 1802
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DPH2 Antibody 25ul

Anti-DPH2 Antibody 25ul