DUSP23,DUSP25
  • DUSP23,DUSP25

Anti-DUSP23 Antibody 25ul

Ref: AN-HPA045792-25ul
Anti-DUSP23

Información del producto

Polyclonal Antibody against Human DUSP23, Gene description: dual specificity phosphatase 23, Alternative Gene Names: DUSP25, FLJ20442, Validated applications: IHC, WB, Uniprot ID: Q9BVJ7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DUSP23
Gene Description dual specificity phosphatase 23
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence IVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Immunogen IVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DUSP25, FLJ20442
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BVJ7
HTS Code 3002150000
Gene ID 54935
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DUSP23 Antibody 25ul

Anti-DUSP23 Antibody 25ul