SPATA33,C16orf55
  • SPATA33,C16orf55

Anti-SPATA33 Antibody 100ul

Ref: AN-HPA045648-100ul
Anti-SPATA33

Información del producto

Polyclonal Antibody against Human SPATA33, Gene description: spermatogenesis associated 33, Alternative Gene Names: C16orf55, FLJ31606, Validated applications: IHC, WB, Uniprot ID: Q96N06, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SPATA33
Gene Description spermatogenesis associated 33
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence SVPKSKEKLMEKHSQEARQADRESEKPVDSLHPGAGTAKHPPPAASLEEKPDVKQKSSRKK
Immunogen SVPKSKEKLMEKHSQEARQADRESEKPVDSLHPGAGTAKHPPPAASLEEKPDVKQKSSRKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C16orf55, FLJ31606
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96N06
HTS Code 3002150000
Gene ID 124045
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SPATA33 Antibody 100ul

Anti-SPATA33 Antibody 100ul