PATE4,FLJ41047
  • PATE4,FLJ41047

Anti-PATE4 Antibody 25ul

Ref: AN-HPA045632-25ul
Anti-PATE4

Información del producto

Polyclonal Antibody against Human PATE4, Gene description: prostate and testis expressed 4, Alternative Gene Names: FLJ41047, PATE-B, Validated applications: IHC, Uniprot ID: P0C8F1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PATE4
Gene Description prostate and testis expressed 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GLKCNTCIYTEGWKCMAGRGTCIAKENELCSTTAYFRGDKHMYSTHMCKYKCREEESSKRGLLRVTLCGDRNFCNVF
Immunogen GLKCNTCIYTEGWKCMAGRGTCIAKENELCSTTAYFRGDKHMYSTHMCKYKCREEESSKRGLLRVTLCGDRNFCNVF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ41047, PATE-B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P0C8F1
HTS Code 3002150000
Gene ID 399968
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PATE4 Antibody 25ul

Anti-PATE4 Antibody 25ul