DEFB107A,DEFB-7
  • DEFB107A,DEFB-7

Anti-DEFB107A Antibody 25ul

Ref: AN-HPA045626-25ul
Anti-DEFB107A

Información del producto

Polyclonal Antibody against Human DEFB107A, Gene description: defensin, beta 107A, Alternative Gene Names: DEFB-7, DEFB107, Validated applications: IHC, Uniprot ID: Q8IZN7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DEFB107A
Gene Description defensin, beta 107A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP
Immunogen QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DEFB-7, DEFB107
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IZN7
HTS Code 3002150000
Gene ID 245910
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DEFB107A Antibody 25ul

Anti-DEFB107A Antibody 25ul