IL17REL,FLJ41993
  • IL17REL,FLJ41993

Anti-IL17REL Antibody 25ul

Ref: AN-HPA045546-25ul
Anti-IL17REL

Información del producto

Polyclonal Antibody against Human IL17REL, Gene description: interleukin 17 receptor E-like, Alternative Gene Names: FLJ41993, Validated applications: IHC, Uniprot ID: Q6ZVW7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IL17REL
Gene Description interleukin 17 receptor E-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PVRVTANSVSQAVFLPYSQELPCLCLEGWSATPDAVRIQICPFENDTEALEVLWDTVYYHPESQTLSWEPACPVSGHVSLCWR
Immunogen PVRVTANSVSQAVFLPYSQELPCLCLEGWSATPDAVRIQICPFENDTEALEVLWDTVYYHPESQTLSWEPACPVSGHVSLCWR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ41993
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZVW7
HTS Code 3002150000
Gene ID 400935
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IL17REL Antibody 25ul

Anti-IL17REL Antibody 25ul