MRPS26,C20orf193
  • MRPS26,C20orf193

Anti-MRPS26 Antibody 25ul

Ref: AN-HPA045472-25ul
Anti-MRPS26

Información del producto

Polyclonal Antibody against Human MRPS26, Gene description: mitochondrial ribosomal protein S26, Alternative Gene Names: C20orf193, dJ534B8.3, MRP-S13, MRP-S26, RPMS13, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BYN8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MRPS26
Gene Description mitochondrial ribosomal protein S26
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence EVLQLQEEVKNFITRENLEARVEAALDSRKNYNWAITREGLVVRPQRRDS
Immunogen EVLQLQEEVKNFITRENLEARVEAALDSRKNYNWAITREGLVVRPQRRDS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf193, dJ534B8.3, MRP-S13, MRP-S26, RPMS13
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BYN8
HTS Code 3002150000
Gene ID 64949
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPS26 Antibody 25ul

Anti-MRPS26 Antibody 25ul