HARBI1,C11orf77
  • HARBI1,C11orf77

Anti-HARBI1 Antibody 25ul

Ref: AN-HPA045457-25ul
Anti-HARBI1

Información del producto

Polyclonal Antibody against Human HARBI1, Gene description: harbinger transposase derived 1, Alternative Gene Names: C11orf77, FLJ32675, Validated applications: ICC, WB, Uniprot ID: Q96MB7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HARBI1
Gene Description harbinger transposase derived 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence NCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSV
Immunogen NCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C11orf77, FLJ32675
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96MB7
HTS Code 3002150000
Gene ID 283254
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HARBI1 Antibody 25ul

Anti-HARBI1 Antibody 25ul