STC2,STC-2
  • STC2,STC-2

Anti-STC2 Antibody 25ul

Ref: AN-HPA045372-25ul
Anti-STC2

Información del producto

Polyclonal Antibody against Human STC2, Gene description: stanniocalcin 2, Alternative Gene Names: STC-2, Validated applications: ICC, IHC, WB, Uniprot ID: O76061, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name STC2
Gene Description stanniocalcin 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence SAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYSDIRR
Immunogen SAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYSDIRR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names STC-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O76061
HTS Code 3002150000
Gene ID 8614
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-STC2 Antibody 25ul

Anti-STC2 Antibody 25ul