BASP1,CAP-23,CAP23
  • BASP1,CAP-23,CAP23

Anti-BASP1 Antibody 100ul

Ref: AN-HPA045218-100ul
Anti-BASP1

Información del producto

Polyclonal Antibody against Human BASP1, Gene description: brain abundant, membrane attached signal protein 1, Alternative Gene Names: CAP-23, CAP23, NAP-22, NAP22, Validated applications: ICC, IHC, WB, Uniprot ID: P80723, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BASP1
Gene Description brain abundant, membrane attached signal protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEP
Immunogen MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAP-23, CAP23, NAP-22, NAP22
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P80723
HTS Code 3002150000
Gene ID 10409
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BASP1 Antibody 100ul

Anti-BASP1 Antibody 100ul