NDUFAF7,C2orf56
  • NDUFAF7,C2orf56

Anti-NDUFAF7 Antibody 25ul

Ref: AN-HPA045217-25ul
Anti-NDUFAF7

Información del producto

Polyclonal Antibody against Human NDUFAF7, Gene description: NADH dehydrogenase (ubiquinone) complex I, assembly factor 7, Alternative Gene Names: C2orf56, MidA, PRO1853, Validated applications: IHC, WB, Uniprot ID: Q7L592, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NDUFAF7
Gene Description NADH dehydrogenase (ubiquinone) complex I, assembly factor 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence ISVHLVEVSQKLSEIQALTLTKEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLPVHKFQKTPQGWREVFVDIDPQVSD
Immunogen ISVHLVEVSQKLSEIQALTLTKEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLPVHKFQKTPQGWREVFVDIDPQVSD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C2orf56, MidA, PRO1853
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7L592
HTS Code 3002150000
Gene ID 55471
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NDUFAF7 Antibody 25ul

Anti-NDUFAF7 Antibody 25ul