RAD51C,FANCO,RAD51L2
  • RAD51C,FANCO,RAD51L2

Anti-RAD51C Antibody 25ul

Ref: AN-HPA045198-25ul
Anti-RAD51C

Información del producto

Polyclonal Antibody against Human RAD51C, Gene description: RAD51 paralog C, Alternative Gene Names: FANCO, RAD51L2, Validated applications: ICC, Uniprot ID: O43502, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RAD51C
Gene Description RAD51 paralog C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVG
Immunogen MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FANCO, RAD51L2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43502
HTS Code 3002150000
Gene ID 5889
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RAD51C Antibody 25ul

Anti-RAD51C Antibody 25ul