ABCB8,EST328128
  • ABCB8,EST328128

Anti-ABCB8 Antibody 25ul

Ref: AN-HPA045187-25ul
Anti-ABCB8

Información del producto

Polyclonal Antibody against Human ABCB8, Gene description: ATP-binding cassette, sub-family B (MDR/TAP), member 8, Alternative Gene Names: EST328128, M-ABC1, MABC1, Validated applications: ICC, IHC, Uniprot ID: Q9NUT2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ABCB8
Gene Description ATP-binding cassette, sub-family B (MDR/TAP), member 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LFRVGIRGGPFPGRLLPPLRFQTFSAVRYSDGYRSSSLLRAVAHLRSQLWAHLPRAPLAPRWSPSAWCWVGGALLGPMVLSKHPHLCLVALCEAEEAPPASSTPHVVGSRFNWKLFWQFL
Immunogen LFRVGIRGGPFPGRLLPPLRFQTFSAVRYSDGYRSSSLLRAVAHLRSQLWAHLPRAPLAPRWSPSAWCWVGGALLGPMVLSKHPHLCLVALCEAEEAPPASSTPHVVGSRFNWKLFWQFL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EST328128, M-ABC1, MABC1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NUT2
HTS Code 3002150000
Gene ID 11194
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ABCB8 Antibody 25ul

Anti-ABCB8 Antibody 25ul