FKBP8,FKBP38,FKBPr38
  • FKBP8,FKBP38,FKBPr38

Anti-FKBP8 Antibody 100ul

Ref: AN-HPA045177-100ul
Anti-FKBP8

Información del producto

Polyclonal Antibody against Human FKBP8, Gene description: FK506 binding protein 8, 38kDa, Alternative Gene Names: FKBP38, FKBPr38, Validated applications: ICC, IHC, WB, Uniprot ID: Q14318, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FKBP8
Gene Description FK506 binding protein 8, 38kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence YDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGK
Immunogen YDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FKBP38, FKBPr38
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14318
HTS Code 3002150000
Gene ID 23770
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FKBP8 Antibody 100ul

Anti-FKBP8 Antibody 100ul