BEX4,BEXL1,FLJ10097
  • BEX4,BEXL1,FLJ10097

Anti-BEX4 Antibody 100ul

Ref: AN-HPA045105-100ul
Anti-BEX4

Información del producto

Polyclonal Antibody against Human BEX4, Gene description: brain expressed, X-linked 4, Alternative Gene Names: BEXL1, FLJ10097, Validated applications: IHC, Uniprot ID: Q9NWD9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BEX4
Gene Description brain expressed, X-linked 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence WAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDF
Immunogen WAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BEXL1, FLJ10097
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NWD9
HTS Code 3002150000
Gene ID 56271
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BEX4 Antibody 100ul

Anti-BEX4 Antibody 100ul