IFT172,NPHP17,osm-1
  • IFT172,NPHP17,osm-1

Anti-IFT172 Antibody 100ul

Ref: AN-HPA044893-100ul
Anti-IFT172

Información del producto

Polyclonal Antibody against Human IFT172, Gene description: intraflagellar transport 172, Alternative Gene Names: NPHP17, osm-1, SLB, wim, Validated applications: IHC, Uniprot ID: Q9UG01, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IFT172
Gene Description intraflagellar transport 172
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SSPGTNCAEAYHSWADLRDVLFNLCENLVKSSEANSPAHEEFKTMLLIAHYYATRSAAQSVKQLETVAARLSVSLLRHTQLLPVDKAFYEAGIAAKAVGWDNMAFIFLNR
Immunogen SSPGTNCAEAYHSWADLRDVLFNLCENLVKSSEANSPAHEEFKTMLLIAHYYATRSAAQSVKQLETVAARLSVSLLRHTQLLPVDKAFYEAGIAAKAVGWDNMAFIFLNR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NPHP17, osm-1, SLB, wim
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UG01
HTS Code 3002150000
Gene ID 26160
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IFT172 Antibody 100ul

Anti-IFT172 Antibody 100ul