EXOC1,BM-102
  • EXOC1,BM-102

Anti-EXOC1 Antibody 100ul

Ref: AN-HPA044873-100ul
Anti-EXOC1

Información del producto

Polyclonal Antibody against Human EXOC1, Gene description: exocyst complex component 1, Alternative Gene Names: BM-102, FLJ10893, SEC3, SEC3L1, Sec3p, Validated applications: ICC, Uniprot ID: Q9NV70, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EXOC1
Gene Description exocyst complex component 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFH
Immunogen CISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BM-102, FLJ10893, SEC3, SEC3L1, Sec3p
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NV70
HTS Code 3002150000
Gene ID 55763
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EXOC1 Antibody 100ul

Anti-EXOC1 Antibody 100ul