C8orf59
  • C8orf59

Anti-C8orf59 Antibody 25ul

Ref: AN-HPA044805-25ul
Anti-C8orf59

Información del producto

Polyclonal Antibody against Human C8orf59, Gene description: chromosome 8 open reading frame 59, Validated applications: ICC, Uniprot ID: Q8N0T1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C8orf59
Gene Description chromosome 8 open reading frame 59
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKVLH
Immunogen MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKVLH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N0T1
HTS Code 3002150000
Gene ID 401466
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C8orf59 Antibody 25ul

Anti-C8orf59 Antibody 25ul