CLCN3,ClC-3,CLC3
  • CLCN3,ClC-3,CLC3

Anti-CLCN3 Antibody 25ul

Ref: AN-HPA044723-25ul
Anti-CLCN3

Información del producto

Polyclonal Antibody against Human CLCN3, Gene description: chloride channel, voltage-sensitive 3, Alternative Gene Names: ClC-3, CLC3, Validated applications: IHC, WB, Uniprot ID: P51790, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CLCN3
Gene Description chloride channel, voltage-sensitive 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence NSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTHLLDLLDEP
Immunogen NSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTHLLDLLDEP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ClC-3, CLC3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51790
HTS Code 3002150000
Gene ID 1182
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CLCN3 Antibody 25ul

Anti-CLCN3 Antibody 25ul