TBC1D24,DFNA65
  • TBC1D24,DFNA65

Anti-TBC1D24 Antibody 100ul

Ref: AN-HPA044712-100ul
Anti-TBC1D24

Información del producto

Polyclonal Antibody against Human TBC1D24, Gene description: TBC1 domain family, member 24, Alternative Gene Names: DFNA65, DFNB86, KIAA1171, TLDC6, Validated applications: IHC, Uniprot ID: Q9ULP9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TBC1D24
Gene Description TBC1 domain family, member 24
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RGKVYQRLIRDIPCRTVTPDASVYSDIVGKIVGKHSSSCLPLPEFVDNTQVPSYCLNARGEGAVRKILLCLANQFPD
Immunogen RGKVYQRLIRDIPCRTVTPDASVYSDIVGKIVGKHSSSCLPLPEFVDNTQVPSYCLNARGEGAVRKILLCLANQFPD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DFNA65, DFNB86, KIAA1171, TLDC6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9ULP9
HTS Code 3002150000
Gene ID 57465
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TBC1D24 Antibody 100ul

Anti-TBC1D24 Antibody 100ul