SGTB,FLJ39002,Sgt2
  • SGTB,FLJ39002,Sgt2

Anti-SGTB Antibody 100ul

Ref: AN-HPA044689-100ul
Anti-SGTB

Información del producto

Polyclonal Antibody against Human SGTB, Gene description: small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta, Alternative Gene Names: FLJ39002, Sgt2, Validated applications: IHC, WB, Uniprot ID: Q96EQ0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SGTB
Gene Description small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence KISPEDTHLAVSQPLTEMFTSSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHM
Immunogen KISPEDTHLAVSQPLTEMFTSSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ39002, Sgt2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96EQ0
HTS Code 3002150000
Gene ID 54557
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SGTB Antibody 100ul

Anti-SGTB Antibody 100ul