KLC1,hKLC1B,hKLC1G
  • KLC1,hKLC1B,hKLC1G

Anti-KLC1 Antibody 100ul

Ref: AN-HPA044617-100ul
Anti-KLC1

Información del producto

Polyclonal Antibody against Human KLC1, Gene description: kinesin light chain 1, Alternative Gene Names: hKLC1B, hKLC1G, hKLC1J, hKLC1N, hKLC1P, hKLC1R, hKLC1S, KLC, KNS2, KNS2A, Validated applications: IHC, WB, Uniprot ID: Q07866, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KLC1
Gene Description kinesin light chain 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence STMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLE
Immunogen STMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hKLC1B, hKLC1G, hKLC1J, hKLC1N, hKLC1P, hKLC1R, hKLC1S, KLC, KNS2, KNS2A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q07866
HTS Code 3002150000
Gene ID 3831
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KLC1 Antibody 100ul

Anti-KLC1 Antibody 100ul