SPOCK2,KIAA0275
  • SPOCK2,KIAA0275

Anti-SPOCK2 Antibody 25ul

Ref: AN-HPA044605-25ul
Anti-SPOCK2

Información del producto

Polyclonal Antibody against Human SPOCK2, Gene description: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2, Alternative Gene Names: KIAA0275, testican-2, Validated applications: IHC, WB, Uniprot ID: Q92563, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SPOCK2
Gene Description sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence EQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDS
Immunogen EQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0275, testican-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92563
HTS Code 3002150000
Gene ID 9806
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SPOCK2 Antibody 25ul

Anti-SPOCK2 Antibody 25ul