SFTPD,COLEC7,SFTP4
  • SFTPD,COLEC7,SFTP4

Anti-SFTPD Antibody 100ul

Ref: AN-HPA044582-100ul
Anti-SFTPD

Información del producto

Polyclonal Antibody against Human SFTPD, Gene description: surfactant protein D, Alternative Gene Names: COLEC7, SFTP4, SP-D, Validated applications: IHC, WB, Uniprot ID: P35247, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SFTPD
Gene Description surfactant protein D
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTD
Immunogen LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names COLEC7, SFTP4, SP-D
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P35247
HTS Code 3002150000
Gene ID 6441
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SFTPD Antibody 100ul

Anti-SFTPD Antibody 100ul