HINT1,HINT,PKCI-1
  • HINT1,HINT,PKCI-1

Anti-HINT1 Antibody 25ul

Ref: AN-HPA044577-25ul
Anti-HINT1

Información del producto

Polyclonal Antibody against Human HINT1, Gene description: histidine triad nucleotide binding protein 1, Alternative Gene Names: HINT, PKCI-1, PRKCNH1, Validated applications: ICC, IHC, WB, Uniprot ID: P49773, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HINT1
Gene Description histidine triad nucleotide binding protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence IPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVL
Immunogen IPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HINT, PKCI-1, PRKCNH1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49773
HTS Code 3002150000
Gene ID 3094
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HINT1 Antibody 25ul

Anti-HINT1 Antibody 25ul