METTL13,CGI-01
  • METTL13,CGI-01

Anti-METTL13 Antibody 100ul

Ref: AN-HPA044498-100ul
Anti-METTL13

Información del producto

Polyclonal Antibody against Human METTL13, Gene description: methyltransferase like 13, Alternative Gene Names: CGI-01, KIAA0859, Validated applications: ICC, IHC, Uniprot ID: Q8N6R0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name METTL13
Gene Description methyltransferase like 13
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence FVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV
Immunogen FVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-01, KIAA0859
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N6R0
HTS Code 3002150000
Gene ID 51603
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-METTL13 Antibody 100ul

Anti-METTL13 Antibody 100ul