LACTB2,CGI-83
  • LACTB2,CGI-83

Anti-LACTB2 Antibody 100ul

Ref: AN-HPA044391-100ul
Anti-LACTB2

Información del producto

Polyclonal Antibody against Human LACTB2, Gene description: lactamase, beta 2, Alternative Gene Names: CGI-83, Validated applications: ICC, IHC, WB, Uniprot ID: Q53H82, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LACTB2
Gene Description lactamase, beta 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC, WB
Sequence KADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
Immunogen KADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-83
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q53H82
HTS Code 3002150000
Gene ID 51110
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LACTB2 Antibody 100ul

Anti-LACTB2 Antibody 100ul