DHX40,ARG147,DDX40
  • DHX40,ARG147,DDX40

Anti-DHX40 Antibody 100ul

Ref: AN-HPA044350-100ul
Anti-DHX40

Información del producto

Polyclonal Antibody against Human DHX40, Gene description: DEAH (Asp-Glu-Ala-His) box polypeptide 40, Alternative Gene Names: ARG147, DDX40, FLJ22060, PAD, Validated applications: ICC, IHC, Uniprot ID: Q8IX18, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DHX40
Gene Description DEAH (Asp-Glu-Ala-His) box polypeptide 40
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SVGRTFCTMDGRGSPVHIHPSSALHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLHEFNAHDLSSVARREVREDARRRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARF
Immunogen SVGRTFCTMDGRGSPVHIHPSSALHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLHEFNAHDLSSVARREVREDARRRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARG147, DDX40, FLJ22060, PAD
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IX18
HTS Code 3002150000
Gene ID 79665
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DHX40 Antibody 100ul

Anti-DHX40 Antibody 100ul