TSPAN8,CO-029,TM4SF3
  • TSPAN8,CO-029,TM4SF3

Anti-TSPAN8 Antibody 100ul

Ref: AN-HPA044337-100ul
Anti-TSPAN8

Información del producto

Polyclonal Antibody against Human TSPAN8, Gene description: tetraspanin 8, Alternative Gene Names: CO-029, TM4SF3, Validated applications: ICC, IHC, Uniprot ID: P19075, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TSPAN8
Gene Description tetraspanin 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence IVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVY
Immunogen IVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CO-029, TM4SF3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P19075
HTS Code 3002150000
Gene ID 7103
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TSPAN8 Antibody 100ul

Anti-TSPAN8 Antibody 100ul