COPS6,CSN6
  • COPS6,CSN6

Anti-COPS6 Antibody 100ul

Ref: AN-HPA044315-100ul
Anti-COPS6

Información del producto

Polyclonal Antibody against Human COPS6, Gene description: COP9 signalosome subunit 6, Alternative Gene Names: CSN6, MOV34-34KD, Validated applications: ICC, IHC, Uniprot ID: Q7L5N1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name COPS6
Gene Description COP9 signalosome subunit 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence EVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRM
Immunogen EVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CSN6, MOV34-34KD
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7L5N1
HTS Code 3002150000
Gene ID 10980
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-COPS6 Antibody 100ul

Anti-COPS6 Antibody 100ul