SNRNP25,C16orf33
  • SNRNP25,C16orf33

Anti-SNRNP25 Antibody 100ul

Ref: AN-HPA044248-100ul
Anti-SNRNP25

Información del producto

Polyclonal Antibody against Human SNRNP25, Gene description: small nuclear ribonucleoprotein 25kDa (U11/U12), Alternative Gene Names: C16orf33, Validated applications: IHC, WB, Uniprot ID: Q9BV90, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SNRNP25
Gene Description small nuclear ribonucleoprotein 25kDa (U11/U12)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence EEALPHSEAMDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEV
Immunogen EEALPHSEAMDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C16orf33
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BV90
HTS Code 3002150000
Gene ID 79622
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SNRNP25 Antibody 100ul

Anti-SNRNP25 Antibody 100ul