WFIKKN1,C16orf12
  • WFIKKN1,C16orf12

Anti-WFIKKN1 Antibody 25ul

Ref: AN-HPA044237-25ul
Anti-WFIKKN1

Información del producto

Polyclonal Antibody against Human WFIKKN1, Gene description: WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1, Alternative Gene Names: C16orf12, RJD2, WFDC20A, WFIKKN, Validated applications: IHC, Uniprot ID: Q96NZ8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WFIKKN1
Gene Description WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence STCERECSRDQDCAAAEKCCINVCGLHSCVAARFPGSPAAPTTAASCEGFVCPQQGSDCDI
Immunogen STCERECSRDQDCAAAEKCCINVCGLHSCVAARFPGSPAAPTTAASCEGFVCPQQGSDCDI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C16orf12, RJD2, WFDC20A, WFIKKN
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96NZ8
HTS Code 3002150000
Gene ID 117166
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WFIKKN1 Antibody 25ul

Anti-WFIKKN1 Antibody 25ul