WDR35,IFT121,IFTA1
  • WDR35,IFT121,IFTA1

Anti-WDR35 Antibody 25ul

Ref: AN-HPA044147-25ul
Anti-WDR35

Información del producto

Polyclonal Antibody against Human WDR35, Gene description: WD repeat domain 35, Alternative Gene Names: IFT121, IFTA1, KIAA1336, MGC33196, Validated applications: IHC, Uniprot ID: Q9P2L0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WDR35
Gene Description WD repeat domain 35
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SLPNVGLIQKYSLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLKLERRDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGY
Immunogen SLPNVGLIQKYSLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLKLERRDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IFT121, IFTA1, KIAA1336, MGC33196
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P2L0
HTS Code 3002150000
Gene ID 57539
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WDR35 Antibody 25ul

Anti-WDR35 Antibody 25ul